Structure of PDB 3av2 Chain E Binding Site BS01

Receptor Information
>3av2 Chain E (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSA
AIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>3av2 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3av2 Structures of human nucleosomes containing major histone H3 variants
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 P43 G44 V46 R49 R63 K64 L65 P66 R69 R83
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 P6 G7 V9 R12 R26 K27 L28 P29 R32 R46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0001556 oocyte maturation
GO:0001649 osteoblast differentiation
GO:0006334 nucleosome assembly
GO:0006997 nucleus organization
GO:0007283 spermatogenesis
GO:0007286 spermatid development
GO:0007338 single fertilization
GO:0007566 embryo implantation
GO:0008283 cell population proliferation
GO:0008584 male gonad development
GO:0030307 positive regulation of cell growth
GO:0031508 pericentric heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0032200 telomere organization
GO:0035264 multicellular organism growth
GO:0042692 muscle cell differentiation
GO:0048477 oogenesis
GO:0090230 regulation of centromere complex assembly
GO:1902340 negative regulation of chromosome condensation
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0000939 inner kinetochore
GO:0001740 Barr body
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3av2, PDBe:3av2, PDBj:3av2
PDBsum3av2
PubMed21636898
UniProtP84243|H33_HUMAN Histone H3.3 (Gene Name=H3-3A)

[Back to BioLiP]