Structure of PDB 2z4e Chain E Binding Site BS01

Receptor Information

>2z4e Chain E (length=296) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEE
IIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFG
RKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIE
MEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGE
NRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPN
GRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP

Ligand information

>2z4e Chain J (length=5) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GHRPY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2z4e Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
Resolution	2.7 Å
Binding residue (original residue number in PDB)	L360 N364 M367 T368 W385 E397 R406 C407 H408 D432 M438
Binding residue (residue number reindexed from 1)	L197 N201 M204 T205 W222 E234 R243 C244 H245 D269 M275

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005102	signaling receptor binding

	Biological Process
GO:0007596	blood coagulation
GO:0030168	platelet activation
GO:0051258	protein polymerization

	Cellular Component
GO:0005577	fibrinogen complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2z4e, PDBe:2z4e, PDBj:2z4e
PDBsum	2z4e
PubMed	17688324
UniProt	P02675\|FIBB_HUMAN Fibrinogen beta chain (Gene Name=FGB)

[Back to BioLiP]