Structure of PDB 2y0n Chain E Binding Site BS01

Receptor Information
>2y0n Chain E (length=39) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEVTSFFPESLLITPFLPVVAFGRPLPKLAPQNFELPWL
Ligand information
>2y0n Chain G (length=29) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VTSFFPITPFLPVVAFGRPLPKLAPQNFE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y0n Structural Basis for Mof and Msl3 Recruitment Into the Dosage Compensation Complex by Msl1.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		P570 F571 L572 P573 V574 L581 K583
Binding residue
(residue number reindexed from 1)		P15 F16 L17 P18 V19 L26 K28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:2y0n, PDBe:2y0n, PDBj:2y0n
PDBsum2y0n
PubMed21217699
UniProtQ6PDM1|MSL1_MOUSE Male-specific lethal 1 homolog (Gene Name=Msl1)

[Back to BioLiP]