Structure of PDB 2xn9 Chain E Binding Site BS01

Receptor Information

>2xn9 Chain E (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTV
YPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWR

Ligand information

>2xn9 Chain F (length=13) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PKYVKQNTLKLAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2xn9 The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	F13 P56 D57 W61 L67 R71 Y78 H81 N82 V85
Binding residue (residue number reindexed from 1)	F12 P55 D56 W60 L66 R70 Y77 H80 N81 V84

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2xn9, PDBe:2xn9, PDBj:2xn9
PDBsum	2xn9
PubMed	21081917
UniProt	P01911\|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]