Structure of PDB 2w4l Chain E Binding Site BS01

Receptor Information

>2w4l Chain E (length=162) Species: 9606 (Homo sapiens)

YLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCS
DDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNLTDVKGCSMYVALFPCN
ECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSK
IVIDFDSINSRP

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 2w4l Chain E Residue 1174

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2w4l The Crystal Structure of Human Dcmp Deaminase
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): H84 C110 C113
• Binding residue (residue number reindexed from 1): H73 C99 C102
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 3.5.4.12: dCMP deaminase.

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004132 dCMP deaminase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding
• GO:0070694 deoxyribonucleoside 5'-monophosphate N-glycosidase activity

Biological Process

• GO:0006220 pyrimidine nucleotide metabolic process
• GO:0009165 nucleotide biosynthetic process
• GO:0009972 cytidine deamination
• GO:0043174 nucleoside salvage

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2w4l, PDBe:2w4l, PDBj:2w4l
• PDBsum: 2w4l
• UniProt: P32321|DCTD_HUMAN Deoxycytidylate deaminase (Gene Name=DCTD)