Structure of PDB 2uwe Chain E Binding Site BS01

Receptor Information
>2uwe Chain E (length=194) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSVTQTEGLVTLTEGLPVMLNCTYQSTYSPFLFWYVQHLNEAPKLLLKS
FTDNKRPEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALFLASSSFS
KLVFGQGTSLSVVPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPK
TMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2uwe Single Mhc Mutation Eliminates Enthalpy Associated with T Cell Receptor Binding.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		A97 S98 F101 S102
Binding residue
(residue number reindexed from 1)		A95 S96 F99 S100
External links