Structure of PDB 2rln Chain E Binding Site BS01

Receptor Information
>2rln Chain E (length=104) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQT
NCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHF
DASV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rln Thermodynamic and structural consequences of changing a sulfur atom to a methylene group in the M13Nle mutation in ribonuclease-S.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		S21 Y25 R33 L35 K41 N44 T45 F46 V47 H48 E49 L51 V54
Binding residue
(residue number reindexed from 1)		S1 Y5 R13 L15 K21 N24 T25 F26 V27 H28 E29 L31 V34
Enzymatic activity
Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:2rln, PDBe:2rln, PDBj:2rln
PDBsum2rln
PubMed8031793
UniProtP61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)

[Back to BioLiP]