Structure of PDB 2qkk Chain E Binding Site BS01

Receptor Information
>2qkk Chain E (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQR
AEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSA
GKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qkk Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
Resolution3.2 Å
Binding residue
(original residue number in PDB)		C147 C148 S149 S150 N151 N182 E186 M212 H260 G263 R278
Binding residue
(residue number reindexed from 1)		C13 C14 S15 S16 N17 N48 E52 M78 H126 G129 R144
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2qkk, PDBe:2qkk, PDBj:2qkk
PDBsum2qkk
PubMed17964265
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]