Structure of PDB 2qa9 Chain E Binding Site BS01

Receptor Information
>2qa9 Chain E (length=185) Species: 1911 (Streptomyces griseus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTV
LGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRR
GSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTR
AIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qa9 1.2A-resolution crystal structures reveal the second tetrahedral intermediates of streptogrisin B (SGPB).
Resolution1.18 Å
Binding residue
(original residue number in PDB)		H57 Y171 A192 E192A P192B G193 S195 S214 G215 G216 S217 F227
Binding residue
(residue number reindexed from 1)		H33 Y120 A136 E137 P138 G139 S141 S156 G157 G158 S159 F169
Enzymatic activity
Catalytic site (original residue number in PDB) S195 S214
Catalytic site (residue number reindexed from 1) S141 S156
Enzyme Commision number 3.4.21.81: streptogrisin B.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2qa9, PDBe:2qa9, PDBj:2qa9
PDBsum2qa9
PubMed18157955
UniProtP00777|PRTB_STRGR Streptogrisin-B (Gene Name=sprB)

[Back to BioLiP]