Structure of PDB 2q6w Chain E Binding Site BS01

Receptor Information
>2q6w Chain E (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTE
LGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVY
PAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGD
WTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2q6w Crystallographic Structure of the Human Leukocyte Antigen DRA, DRB3*0101: Models of a Directional Alloimmune Response and Autoimmunity
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R11 S13 Y26 W61 K71 R74 N77 Y78 H81 N82 V85 G86
Binding residue
(residue number reindexed from 1)		R9 S11 Y24 W59 K69 R72 N75 Y76 H79 N80 V83 G84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2q6w, PDBe:2q6w, PDBj:2q6w
PDBsum2q6w
PubMed17583734
UniProtP79483|DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain (Gene Name=HLA-DRB3)

[Back to BioLiP]