Structure of PDB 2pg1 Chain E Binding Site BS01

Receptor Information
>2pg1 Chain E (length=104) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQK
PYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVF
GLAV
Ligand information
>2pg1 Chain J (length=29) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IKLGMAKITQVDFPPREIVTYTKETQTPV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pg1 Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H34 N38 E46 L49
Binding residue
(residue number reindexed from 1)		H27 N31 E39 L42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0045505 dynein intermediate chain binding
GO:0051959 dynein light intermediate chain binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0007018 microtubule-based movement
GO:0007286 spermatid development
GO:0008090 retrograde axonal transport
GO:0008340 determination of adult lifespan
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0030286 dynein complex
GO:0032991 protein-containing complex
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pg1, PDBe:2pg1, PDBj:2pg1
PDBsum2pg1
PubMed17551010
UniProtQ94524|DYLT_DROME Dynein light chain Tctex-type (Gene Name=Dlc90F)

[Back to BioLiP]