Structure of PDB 2ozb Chain E Binding Site BS01

Receptor Information
>2ozb Chain E (length=240) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALD
YIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEEL
ERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGV
AGGLTNLSKMPACNIMLLGAQRSVLPHTGYIYHSDIVQSLPPDLRRKAAR
LVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQE
Ligand information
>2ozb Chain F (length=33) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucguagccaaugagguuuauccgaggcgcgau
<<<<<.<<<.....<<.....>>..>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ozb Binding of the human Prp31 Nop domain to a composite RNA-protein platform in U4 snRNP.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
C247 N248 L251 L252 H270 R293 A297 K298
Binding residue
(residue number reindexed from 1)
C163 N164 L167 L168 H177 R200 A204 K205
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2ozb, PDBe:2ozb, PDBj:2ozb
PDBsum2ozb
PubMed17412961
UniProtQ8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)

[Back to BioLiP]