Structure of PDB 2om7 Chain E Binding Site BS01

Receptor Information
>2om7 Chain E (length=124) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEA
Ligand information
>2om7 Chain C (length=96) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccgucacgccaugggagcgggcucuacccgaagucgccgggagccuac
gggcaggcgccgaggguagggcccgugacuggggcgaagucguaac
<..<<.<.<<<<.<<<..<<<<<<<<<<<<<...<.<<<<....<<<...
.>>>.>>>>.>..>>>>>>>>>>>>>..>>>.>>>>..>.>>...>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2om7 Structural basis for interaction of the ribosome with the switch regions of GTP-bound elongation factors.
Resolution7.3 Å
Binding residue
(original residue number in PDB)		K47 P94
Binding residue
(residue number reindexed from 1)		K43 P90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2om7, PDBe:2om7, PDBj:2om7
PDBsum2om7
PubMed17349960
UniProtQ5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]