Structure of PDB 2mf0 Chain E Binding Site BS01

Receptor Information
>2mf0 Chain E (length=59) Species: 220664 (Pseudomonas protegens Pf-5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR
IQAGLTAPD
Ligand information
>2mf0 Chain G (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugucgacggauagacacagccaucaaggacgauggucaggacaucgcagg
aagcgauucaucaggacgauga
<<<<........>>>>..<<<<<<......>>>>>>.......<<<<...
..>>>>..<<<<.....>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mf0 Structural basis of the non-coding RNA RsmZ acting as a protein sponge.
ResolutionN/A
Binding residue
(original residue number in PDB)		R31 A36 P37 K38 V40 A41 V42 H43 R44
Binding residue
(residue number reindexed from 1)		R31 A36 P37 K38 V40 A41 V42 H43 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0006109 regulation of carbohydrate metabolic process
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0045947 negative regulation of translational initiation
GO:0045948 positive regulation of translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mf0, PDBe:2mf0, PDBj:2mf0
PDBsum2mf0
PubMed24828038
UniProtP0DPC3|CSRA1_PSEPH Translational regulator CsrA1 (Gene Name=csrA1)

[Back to BioLiP]