Structure of PDB 2hzv Chain E Binding Site BS01

Receptor Information
>2hzv Chain E (length=131) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGT
QGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAV
LKGDMGDVQHFADDVIAQRGVRHGHLQCLPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hzv NikR-operator complex structure and the mechanism of repressor activation by metal ions.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
R3 T5 T7
Binding residue
(residue number reindexed from 1)
R3 T5 T7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016151 nickel cation binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010045 response to nickel cation
GO:2000143 negative regulation of DNA-templated transcription initiation
Cellular Component
GO:0005667 transcription regulator complex
GO:0032993 protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2hzv, PDBe:2hzv, PDBj:2hzv
PDBsum2hzv
PubMed16945905
UniProtP0A6Z6|NIKR_ECOLI Nickel-responsive regulator (Gene Name=nikR)

[Back to BioLiP]