Structure of PDB 2hnt Chain E Binding Site BS01

Receptor Information
>2hnt Chain E (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRET
AASLLQAGYKGRVTGWG
Ligand information
>2hnt Chain L (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADCGLRPLFEKKSLEDKTERELLESYID
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hnt Crystallographic structure of human gamma-thrombin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D116 H119 C122 L129C Y134 K135 R137
Binding residue
(residue number reindexed from 1)		D38 H41 C44 L54 Y59 K60 R62
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2hnt, PDBe:2hnt, PDBj:2hnt
PDBsum2hnt
PubMed8071320
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]