Structure of PDB 2h1o Chain E Binding Site BS01

Receptor Information
>2h1o Chain E (length=68) Species: 485 (Neisseria gonorrhoeae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASVVIRNLSEATHNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSM
LASIGQEIGGVELEDVRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h1o Structure of FitAB from Neisseria gonorrhoeae bound to DNA reveals a tetramer of toxin-antitoxin heterodimers containing pin domains and ribbon-helix-helix motifs.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S3 V5 R7
Binding residue
(residue number reindexed from 1)		S2 V4 R6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:2h1o, PDBe:2h1o, PDBj:2h1o
PDBsum2h1o
PubMed16982615
UniProtQ5F881|FITA_NEIG1 Antitoxin FitA (Gene Name=fitA)

[Back to BioLiP]