Structure of PDB 1zgl Chain E Binding Site BS01

Receptor Information
>1zgl Chain E (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVT
ELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTV
YPRTNLLVCSVNGFYPGSIEVRWFRNSQEVVSTGLIQNGDWTFQTLVMLE
PRSGEVYTCQVEHPSVTSPLTVEWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zgl Structure of a human autoimmune TCR bound to a myelin basic protein self-peptide and a multiple sclerosis-associated MHC class II molecule.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
Y13 F26 D57 Y60 W61 R71 T77 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)
Y12 F25 D56 Y59 W60 R70 T76 Y77 H80 N81 V84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1zgl, PDBe:1zgl, PDBj:1zgl
PDBsum1zgl
PubMed16079912
UniProtQ30154|DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain (Gene Name=HLA-DRB5)

[Back to BioLiP]