Structure of PDB 1zfp Chain E Binding Site BS01

Receptor Information
>1zfp Chain E (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDV
QHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zfp Structural basis for the high affinity of amino-aromatic SH2 phosphopeptide ligands.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R67 R86 S88 S90 S96 Q106 H107 F108 K109 L120 W121
Binding residue
(residue number reindexed from 1)		R12 R31 S33 S35 S41 Q51 H52 F53 K54 L65 W66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1zfp, PDBe:1zfp, PDBj:1zfp
PDBsum1zfp
PubMed9642078
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]