Structure of PDB 1z3l Chain E Binding Site BS01

Receptor Information
>1z3l Chain E (length=104) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQT
NCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHF
DASV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1z3l Attempts to delineate the relative contributions of changes in hydrophobicity and packing to changes in stability of ribonuclease S mutants.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
Y25 R33 L35 N44 T45 F46 V47 H48 E49 L51 F120
Binding residue
(residue number reindexed from 1)
Y5 R13 L15 N24 T25 F26 V27 H28 E29 L31 F100
Enzymatic activity
Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:1z3l, PDBe:1z3l, PDBj:1z3l
PDBsum1z3l
PubMed15823052
UniProtP61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)

[Back to BioLiP]