Structure of PDB 1ysh Chain E Binding Site BS01

Receptor Information
>1ysh Chain E (length=84) Species: 4530 (Oryza sativa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKHLERNRKDKDSKFR
LILVESRIHRLARYYKRTKKLPPTWKYESTTAST
Ligand information
>1ysh Chain A (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaugaagcgugccgaaaggcacguggaa
......<<<<<<<....>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ysh Localization and dynamic behavior of ribosomal protein L30e
Resolution9.5 Å
Binding residue
(original residue number in PDB)		E119 H123 T144 T145 A146 S147 T148
Binding residue
(residue number reindexed from 1)		E55 H59 T80 T81 A82 S83 T84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ysh, PDBe:1ysh, PDBj:1ysh
PDBsum1ysh
PubMed15864315
UniProtQ69UI2|RS131_ORYSJ Small ribosomal subunit protein uS15z (Gene Name=Os08g0117200)

[Back to BioLiP]