Structure of PDB 1yfl Chain E Binding Site BS01

Receptor Information

>1yfl Chain E (length=248) Species: 10665 (Tequatrovirus T4)

MLGAIAYTGNKQSLLPELKSHFPKYNRFVDLFCGGLSVSLNVNGPVLAND
IQEPIIEMYKRLINVSWDDVLKVIKQYKLSKTSKEEFLKLREDYNKTRDP
LLLYVLHFHGFSNMIRINDKGNFTTPFGKRTINKNSEKRFNHFKQNCDKI
IFSSLHFKDVKILDGDFVYVDPPYLITVADYNKFWSEDEEKDLLNLLDSL
NDRGIKFGLSNVLEHHGKENTLLKEWSKKYNVKHLNKKNGTDEVYIFN

Ligand information

>1yfl Chain H (length=16)

tcacaggatcctgtga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1yfl Transition from Nonspecific to Specific DNA Interactions along the Substrate-Recognition Pathway of Dam Methyltransferase.
• Resolution: 3.09 Å
• Binding residue (original residue number in PDB): R91 F111 S112 R116 N118 P126 G128 R130
• Binding residue (residue number reindexed from 1): R91 F111 S112 R116 N118 P126 G128 R130

Enzymatic activity

• Enzyme Commision number: 2.1.1.72: site-specific DNA-methyltransferase (adenine-specific).

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0008168 methyltransferase activity
• GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity
• GO:0009008 DNA-methyltransferase activity
• GO:0043565 sequence-specific DNA binding
• GO:1904047 S-adenosyl-L-methionine binding

Biological Process

• GO:0006260 DNA replication
• GO:0006298 mismatch repair
• GO:0009307 DNA restriction-modification system
• GO:0019049 virus-mediated perturbation of host defense response
• GO:0032259 methylation
• GO:0052170 symbiont-mediated suppression of host innate immune response
• GO:0099018 symbiont-mediated evasion of host restriction-modification system

External links

• PDB: RCSB:1yfl, PDBe:1yfl, PDBj:1yfl
• PDBsum: 1yfl
• PubMed: 15882618
• UniProt: P04392|DMA_BPT4 DNA adenine methylase (Gene Name=DAM)