Structure of PDB 1xls Chain E Binding Site BS01

Receptor Information
>1xls Chain E (length=242) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQQQKELVQILLGAHTRHVGPLFDQFVQFRPPAYLFMHHRPFQPRGPVLP
LLTHFADINTFMVQQIIKFTKDLPLFRSLTMEDQISLLKGAAVEILHISL
NTTFCLQTENFFCGPLCYKMEDAVHAGFQYEFLESILHFHKNLKGLHLQE
PEYVLMAATALFSPDRPGVTQREEIDQLQEEMALILNNHIMEQQSRLQSR
FLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS
Ligand information
>1xls Chain M (length=18) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AKENALLRYLLDKDDTKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xls The nuclear xenobiotic receptor CAR: structural determinants of constitutive activation and heterodimerization.
Resolution2.96 Å
Binding residue
(original residue number in PDB)		I183 K184 K187 R193 M197 I201 K205 L352 E355
Binding residue
(residue number reindexed from 1)		I67 K68 K71 R77 M81 I85 K89 L236 E239
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1xls, PDBe:1xls, PDBj:1xls
PDBsum1xls
PubMed15610733
UniProtO35627|NR1I3_MOUSE Nuclear receptor subfamily 1 group I member 3 (Gene Name=Nr1i3)

[Back to BioLiP]