Structure of PDB 1ucy Chain E Binding Site BS01

Receptor Information
>1ucy Chain E (length=109) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDA
CEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWI
QKVIDRLGS
Ligand information
>1ucy Chain F (length=12) Species: 9543 (Macaca fuscata fuscata) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DFLAEGGGVRPR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ucy Bovine thrombin complexed with an uncleavable analog of residues 7-19 of fibrinogen A alpha: geometry of the catalytic triad and interactions of the P1', P2', and P3' substrate residues.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R173 D189 A190 E192 G193 S195 W215 G216
Binding residue
(residue number reindexed from 1)		R28 D49 A50 E52 G53 S55 W77 G78
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ucy, PDBe:1ucy, PDBj:1ucy
PDBsum1ucy
PubMed8855938
UniProtP00735|THRB_BOVIN Prothrombin (Gene Name=F2)

[Back to BioLiP]