Structure of PDB 1u35 Chain E Binding Site BS01

Receptor Information
>1u35 Chain E (length=98) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>1u35 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaatccgctgaacatgccttttgatggagc
agtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u35 Structural characterization of the histone variant macroH2A.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		H639 R640 Y641 P643 G644 V646 R649 R663 K664 L665 P666 R669
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 P6 G7 V9 R12 R26 K27 L28 P29 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u35, PDBe:1u35, PDBj:1u35
PDBsum1u35
PubMed16107708
UniProtP68433|H31_MOUSE Histone H3.1 (Gene Name=H3c1)

[Back to BioLiP]