Structure of PDB 1tze Chain E Binding Site BS01

Receptor Information
>1tze Chain E (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGND
VQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tze Structural basis for specificity of Grb2-SH2 revealed by a novel ligand binding mode.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
R67 R86 S88 S90 S96 H107 F108 K109 W121
Binding residue
(residue number reindexed from 1)
R13 R32 S34 S36 S42 H53 F54 K55 W67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1tze, PDBe:1tze, PDBj:1tze
PDBsum1tze
PubMed8673601
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]