Structure of PDB 1smr Chain E Binding Site BS01

Receptor Information

>1smr Chain E (length=331) Species: 10090 (Mus musculus)

TDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSR
LYLACGIHSLYESSDSSSYMENGDDFTIHYGSGRVKGFLSQDSVTVGGIT
VTQTFGEVTQLPLIPFMLAQFDGVLGMGFPAQAVGGVTPVFDHILSQGVL
KEKVFSVYYNRGPHLLGGEVVLGGSDPQHYQGDFHYVSLSKTDSWQITMK
GVSVGSSTLLCEEGCEVVVDTGSSFISAPTSSLKLIMQALGAKEKRLHEY
VVSCSQVPTLPDISFNLGGRAYTLSSTDYVLQRDKLCTVALHAMDIPPPT
GPVWVLGATFIRKFYTEFDRHNNRIGFALAR

Ligand information

>1smr Chain F (length=8) Species: 10116 (Rattus norvegicus)

HPFHLYYS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1smr X-ray analysis at 2.0 A resolution of mouse submaxillary renin complexed with a decapeptide inhibitor CH-66, based on the 4-16 fragment of rat angiotensinogen.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): S12 D32 G34 S35 I73 H74 Y75 G76 S77 P111 L114 A115 F117 Q128 D215 G217 S218 S219 F220 S222 P294 T295 V300
• Binding residue (residue number reindexed from 1): S15 D35 G37 S38 I78 H79 Y80 G81 S82 P115 L118 A119 F121 Q132 D220 G222 S223 S224 F225 S227 P299 T300 V305

Enzymatic activity

• Catalytic site (original residue number in PDB): D32 S35 N37 W39 Y75 D215 S218
• Catalytic site (residue number reindexed from 1): D35 S38 N40 W42 Y80 D220 S223
• Enzyme Commision number: 3.4.23.15: renin.

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:1smr, PDBe:1smr, PDBj:1smr
• PDBsum: 1smr
• PubMed: 8107115
• UniProt: P00796|RENI2_MOUSE Renin-2 (Gene Name=Ren2)