Structure of PDB 1qg1 Chain E Binding Site BS01

Receptor Information
>1qg1 Chain E (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDV
QHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP
QQPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qg1 Solution structure of the SH2 domain of Grb2 complexed with the Shc-derived phosphotyrosine-containing peptide.
ResolutionN/A
Binding residue
(original residue number in PDB)
R12 R31 S33 Q51 H52 F53 K54 L65 W66
Binding residue
(residue number reindexed from 1)
R12 R31 S33 Q51 H52 F53 K54 L65 W66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1qg1, PDBe:1qg1, PDBj:1qg1
PDBsum1qg1
PubMed10356320
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]