Structure of PDB 1pue Chain E Binding Site BS01

Receptor Information
>1pue Chain E (length=88) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKG
NRKKMTYEKMARALRNYGKTGEVKKVKKKLTYQFSGEV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pue A new pattern for helix-turn-helix recognition revealed by the PU.1 ETS-domain-DNA complex.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S205 K208 R222 R232 R235 K245 K249 L250
Binding residue
(residue number reindexed from 1)		S35 K38 R52 R62 R65 K75 K79 L80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pue, PDBe:1pue, PDBj:1pue
PDBsum1pue
PubMed8602247
UniProtP17433|SPI1_MOUSE Transcription factor PU.1 (Gene Name=Spi1)

[Back to BioLiP]