Structure of PDB 1p3b Chain E Binding Site BS01

Receptor Information
>1p3b Chain E (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>1p3b Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p3b Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K637 H639 R640 Y641 G644 V646 R649 R663 K664 L665 P666 R669 R683
Binding residue
(residue number reindexed from 1)		K1 H3 R4 Y5 G8 V10 R13 R27 K28 L29 P30 R33 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1p3b, PDBe:1p3b, PDBj:1p3b
PDBsum1p3b
PubMed14739929
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]