Structure of PDB 1oxn Chain E Binding Site BS01

Receptor Information

>1oxn Chain E (length=94) Species: 9606 (Homo sapiens)

GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFC
YGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHS

Ligand information

>1oxn Chain F (length=4)

AEAV

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1oxn Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP)
• Resolution: 2.2 Å
• Binding residue (original residue number in PDB): Q132 S133 D138 E143 W147
• Binding residue (residue number reindexed from 1): Q55 S56 D61 E66 W70

Enzymatic activity

• Catalytic site (original residue number in PDB): F81
• Catalytic site (residue number reindexed from 1): F4
• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

External links

• PDB: RCSB:1oxn, PDBe:1oxn, PDBj:1oxn
• PDBsum: 1oxn
• PubMed: 12846571
• UniProt: Q96CA5|BIRC7_HUMAN Baculoviral IAP repeat-containing protein 7 (Gene Name=BIRC7)