Structure of PDB 1nlw Chain E Binding Site BS01

Receptor Information
>1nlw Chain E (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMR
RKNHTHQQDIDDLKRQNALLEQQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nlw X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H706 E711 R714
Binding residue
(residue number reindexed from 1)		H2 E7 R10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1nlw, PDBe:1nlw, PDBj:1nlw
PDBsum1nlw
PubMed12553908
UniProtP61244|MAX_HUMAN Protein max (Gene Name=MAX)

[Back to BioLiP]