Structure of PDB 1nkp Chain E Binding Site BS01

Receptor Information
>1nkp Chain E (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYM
RRKNHTHQQDIDDLKRQNALLEQQVRALGGC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nkp X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E711 R714
Binding residue
(residue number reindexed from 1)		E8 R11
Binding affinityPDBbind-CN: Kd=90nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1nkp, PDBe:1nkp, PDBj:1nkp
PDBsum1nkp
PubMed12553908
UniProtP61244|MAX_HUMAN Protein max (Gene Name=MAX)

[Back to BioLiP]