Structure of PDB 1mzn Chain E Binding Site BS01

Receptor Information

>1mzn Chain E (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NEDMPVERILEAELAVEPKTETYVEANNDPVTNICQAADKQLFTLVEWAK
RIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHR
NSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLS
NPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLE
HLFFFKLIGDTPIDTFLMEMLEAP

Ligand information

>1mzn Chain F (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KHKILHRLLQD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mzn Molecular Recognition of Agonist Ligands by RXRs
Resolution	1.9 Å
Binding residue (original residue number in PDB)	V2280 K2284 Q2297 V2298 R2302 T2449 F2450 E2453 P2458
Binding residue (residue number reindexed from 1)	V46 K50 Q63 V64 R68 T215 F216 E219 P224

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1mzn, PDBe:1mzn, PDBj:1mzn
PDBsum	1mzn
PubMed	11981034
UniProt	P19793\|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]