Structure of PDB 1ltj Chain E Binding Site BS01

Receptor Information
>1ltj Chain E (length=294) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEI
IRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGR
KWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEM
EDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGEN
RTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNG
RYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ltj 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N364 M367 W385 E397 R406 C407 H408 T431 D432 M438
Binding residue
(residue number reindexed from 1)		N200 M203 W221 E233 R242 C243 H244 T267 D268 M274
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
Biological Process
GO:0007596 blood coagulation
GO:0030168 platelet activation
GO:0051258 protein polymerization
Cellular Component
GO:0005577 fibrinogen complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ltj, PDBe:1ltj, PDBj:1ltj
PDBsum1ltj
PubMed12356313
UniProtP02675|FIBB_HUMAN Fibrinogen beta chain (Gene Name=FGB)

[Back to BioLiP]