Structure of PDB 1lb2 Chain E Binding Site BS01

Receptor Information
>1lb2 Chain E (length=66) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKS
LTEIKDVLASRGLSLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lb2 Structural basis of transcription activation: the CAP-alpha CTD-DNA complex.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R265 P293 N294 G296 K298 S299
Binding residue
(residue number reindexed from 1)		R16 P44 N45 G47 K49 S50
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
Biological Process
GO:0006351 DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1lb2, PDBe:1lb2, PDBj:1lb2
PDBsum1lb2
PubMed12202833
UniProtP0A7Z4|RPOA_ECOLI DNA-directed RNA polymerase subunit alpha (Gene Name=rpoA)

[Back to BioLiP]