Structure of PDB 1kj2 Chain E Binding Site BS01

Receptor Information

>1kj2 Chain E (length=117) Species: 10090 (Mus musculus)

VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTL
RSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAAPDWG
ASAETLYFGSGTRLTVL

Ligand information

>1kj2 Chain Q (length=8) Species: 10090 (Mus musculus)

KVITFIDL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1kj2 A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex.
• Resolution: 2.71 Å
• Binding residue (original residue number in PDB): R50 D99
• Binding residue (residue number reindexed from 1): R51 D98

External links

• PDB: RCSB:1kj2, PDBe:1kj2, PDBj:1kj2
• PDBsum: 1kj2
• PubMed: 11911820
• UniProt: P04214|TVB6_MOUSE T-cell receptor beta chain V region E1