Structure of PDB 1je8 Chain E Binding Site BS01

Receptor Information
>1je8 Chain E (length=67) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMK
LKSRVEAAVWVHQERIF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1je8 Dimerization allows DNA target site recognition by the NarL response regulator.
Resolution2.12 Å
Binding residue
(original residue number in PDB)		P172 N173 K188 K192 S202 R203
Binding residue
(residue number reindexed from 1)		P23 N24 K39 K43 S53 R54
Binding affinityPDBbind-CN: Kd=0.15nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1je8, PDBe:1je8, PDBj:1je8
PDBsum1je8
PubMed12352954
UniProtP0AF28|NARL_ECOLI Nitrate/nitrite response regulator protein NarL (Gene Name=narL)

[Back to BioLiP]