Structure of PDB 1id3 Chain E Binding Site BS01

Receptor Information
>1id3 Chain E (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKEIKLARRLRGER
Ligand information
>1id3 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1id3 Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
H39 R40 Y41 G44 V46 A47 R49 R63 L65 R69 R83
Binding residue
(residue number reindexed from 1)
H2 R3 Y4 G7 V9 A10 R12 R26 L28 R32 R46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008823 cupric reductase (NADH) activity
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0006878 intracellular copper ion homeostasis
GO:0009060 aerobic respiration
GO:0009303 rRNA transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0043935 sexual sporulation resulting in formation of a cellular spore
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1id3, PDBe:1id3, PDBj:1id3
PDBsum1id3
PubMed11566884
UniProtP61830|H3_YEAST Histone H3 (Gene Name=HHT1)

[Back to BioLiP]