Structure of PDB 1i5l Chain E Binding Site BS01

Receptor Information
>1i5l Chain E (length=71) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGE
VVRKVGSVVIRGDTVVFVSPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i5l RNA binding in an Sm core domain: X-ray structure and functional analysis of an archaeal Sm protein complex.
Resolution2.75 Å
Binding residue
(original residue number in PDB)
I36 H37 N39 R63 D65
Binding residue
(residue number reindexed from 1)
I34 H35 N37 R61 D63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1i5l, PDBe:1i5l, PDBj:1i5l
PDBsum1i5l
PubMed11331594
UniProtO29386|RUXX_ARCFU Putative snRNP Sm-like protein (Gene Name=AF_0875)

[Back to BioLiP]