Structure of PDB 1fzf Chain E Binding Site BS01

Receptor Information

>1fzf Chain E (length=296) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEE
IIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFG
RKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIE
MEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGE
NRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPN
GRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP

Ligand information

>1fzf Chain N (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GHRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1fzf Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	N364 M367 W385 R406 C407 H408 D432 M438
Binding residue (residue number reindexed from 1)	N201 M204 W222 R243 C244 H245 D269 M275

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005102	signaling receptor binding

	Biological Process
GO:0007596	blood coagulation
GO:0030168	platelet activation
GO:0051258	protein polymerization

	Cellular Component
GO:0005577	fibrinogen complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1fzf, PDBe:1fzf, PDBj:1fzf
PDBsum	1fzf
PubMed	10074346
UniProt	P02675\|FIBB_HUMAN Fibrinogen beta chain (Gene Name=FGB)

[Back to BioLiP]