Structure of PDB 1fyt Chain E Binding Site BS01

Receptor Information

>1fyt Chain E (length=240) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDV
KMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSSTGLPYGY
TFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPD
HVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYSLSSRLRVSATFWQN
PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA

Ligand information

>1fyt Chain C (length=13) Species: 119210 (H3N2 subtype) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PKYVKQNTLKLAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1fyt Structure of a covalently stabilized complex of a human alphabeta T-cell receptor, influenza HA peptide and MHC class II molecule, HLA-DR1.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	D28 E30 T97 G98
Binding residue (residue number reindexed from 1)	D26 E28 T94 G95

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:1fyt, PDBe:1fyt, PDBj:1fyt
PDBsum	1fyt
PubMed	11060013
UniProt	P01850\|TRBC1_HUMAN T cell receptor beta constant 1 (Gene Name=TRBC1)

[Back to BioLiP]