Structure of PDB 1fv1 Chain E Binding Site BS01

Receptor Information

>1fv1 Chain E (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAV
TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVT
VYPARTQTLQHHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQN
GDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA

Ligand information

>1fv1 Chain F (length=18) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVVHFFKNIVTPRTPPPS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1fv1 Structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two HLA-DR2 proteins.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Y13 Y60 W61 F67 R71 Y78 H81 N82 V85 G86 F89
Binding residue (residue number reindexed from 1)	Y13 Y60 W61 F67 R71 Y78 H81 N82 V85 G86 F89

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1fv1, PDBe:1fv1, PDBj:1fv1
PDBsum	1fv1
PubMed	11080454
UniProt	Q30154\|DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain (Gene Name=HLA-DRB5)

[Back to BioLiP]