Structure of PDB 1f3j Chain E Binding Site BS01

Receptor Information
>1f3j Chain E (length=187) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTEL
GRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLS
RTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWT
FQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f3j Structural basis of peptide binding and presentation by the type I diabetes-associated MHC class II molecule of NOD mice.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		F11 G13 L26 Y30 Y47 Y60 Y61 Y67 T71 E74 T77 H81 N82 E84A E86
Binding residue
(residue number reindexed from 1)		F8 G10 L23 Y27 Y44 Y57 Y58 Y62 T66 E69 T72 H76 N77 E80 E82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1f3j, PDBe:1f3j, PDBj:1f3j
PDBsum1f3j
PubMed10894169
UniProtQ31135

[Back to BioLiP]