Structure of PDB 1dlh Chain E Binding Site BS01

Receptor Information
>1dlh Chain E (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTE
LGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVY
PSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGD
WTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
>1dlh Chain F (length=13) Species: 387147 (Influenza A virus (A/England/878/1969(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKYVKQNTLKLAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dlh Crystal structure of the human class II MHC protein HLA-DR1 complexed with an influenza virus peptide.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		F13 Y47 D57 Y60 W61 L67 Q70 R71 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)		F11 Y45 D55 Y58 W59 L65 Q68 R69 Y76 H79 N80 V83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1dlh, PDBe:1dlh, PDBj:1dlh
PDBsum1dlh
PubMed8145819
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]