Structure of PDB 1d0j Chain E Binding Site BS01

Receptor Information
>1d0j Chain E (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYT
SRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLM
LLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNS
YVRDDAIFIKAIVDLTGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d0j The structural basis for the recognition of diverse receptor sequences by TRAF2.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R393 Y395 D399 F410 F447 A466 S467 G468
Binding residue
(residue number reindexed from 1)		R60 Y62 D66 F77 F114 A133 S134 G135
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0007250 activation of NF-kappaB-inducing kinase activity
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0042981 regulation of apoptotic process
GO:0046328 regulation of JNK cascade
GO:0051865 protein autoubiquitination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1d0j, PDBe:1d0j, PDBj:1d0j
PDBsum1d0j
PubMed10518213
UniProtQ12933|TRAF2_HUMAN TNF receptor-associated factor 2 (Gene Name=TRAF2)

[Back to BioLiP]