Structure of PDB 1cgm Chain E Binding Site BS01

Receptor Information
>1cgm Chain E (length=160) Species: 12235 (Cucumber green mottle mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYNPITPSKLIAFSASYVPVRTLLNFLVASQGTAFQTQAGRDSFRESLSA
LPSSVVDINSRFPDAGFYAFLNGPVLRPIFVSLLSSTDTRNRVIEVVDPS
NPTTAESLNAVKRTDDASTAARAEIDNLIESISKGFDVYDRASFEAAFSV
VWSEATTSKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cgm Structure determination of cucumber green mottle mosaic virus by X-ray fiber diffraction. Significance for the evolution of tobamoviruses.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		S86 R113 D116 A117 S118 T119 A120 E124
Binding residue
(residue number reindexed from 1)		S86 R113 D116 A117 S118 T119 A120 E124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Cellular Component
GO:0019028 viral capsid
GO:0019029 helical viral capsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1cgm, PDBe:1cgm, PDBj:1cgm
PDBsum1cgm
PubMed8201619
UniProtP69475|CAPSD_CGMVW Capsid protein (Gene Name=CP)

[Back to BioLiP]