Structure of PDB 1aw8 Chain E Binding Site BS01

Receptor Information
>1aw8 Chain E (length=91) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
cCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGA
AAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK
Ligand information
>1aw8 Chain A (length=24) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MIRTMLQGKLHRVKVTHADLHYEG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aw8 Crystal structure of aspartate decarboxylase at 2.2 A resolution provides evidence for an ester in protein self-processing.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		G37 N41 E42 A43 Y58 V91 T92
Binding residue
(residue number reindexed from 1)		G13 N17 E18 A19 Y34 V67 T68
Enzymatic activity
Catalytic site (original residue number in PDB) Y58
Catalytic site (residue number reindexed from 1) Y33
Enzyme Commision number 4.1.1.11: aspartate 1-decarboxylase.
Gene Ontology
Molecular Function
GO:0004068 aspartate 1-decarboxylase activity
Biological Process
GO:0006523 alanine biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1aw8, PDBe:1aw8, PDBj:1aw8
PDBsum1aw8
PubMed9546220
UniProtP0A790|PAND_ECOLI Aspartate 1-decarboxylase (Gene Name=panD)

[Back to BioLiP]