Structure of PDB 6sgb Chain DZ Binding Site BS01

Receptor Information
>6sgb Chain DZ (length=30) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNEAEKHHDLHMFYTLAWWKLGEGIFGVDE
Ligand information
>6sgb Chain UK (length=24) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPPPPPPPPPPPPPPPPPPPPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sgb Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
D71 F75
Binding residue
(residue number reindexed from 1)
D9 F13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005739 mitochondrion
GO:0005763 mitochondrial small ribosomal subunit

View graph for
Cellular Component
External links
PDB RCSB:6sgb, PDBe:6sgb, PDBj:6sgb
PDBsum6sgb
PubMed31515389
UniProtQ587C4

[Back to BioLiP]