Structure of PDB 4v5c Chain DZ Binding Site BS01

Receptor Information
>4v5c Chain DZ (length=176) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQAS
IHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPL
RFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHA
SDLKLPPGVELAVSPEETIAAVVPPE
Ligand information
>4v5c Chain CY (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcaccaF
<<<<<<<...<<..........>>..<<<<<<.....>>>>>>......<
<<<.......>>>>.>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v5c Insights Into Substrate Stabilization from Snapshots of the Peptidyl Transferase Center of the Intact 70S Ribosome
Resolution3.3 Å
Binding residue
(original residue number in PDB)
P176 E178
Binding residue
(residue number reindexed from 1)
P174 E176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v5c, PDBe:4v5c, PDBj:4v5c
PDBsum4v5c
PubMed19363482
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]